Don’t Beam Me Up Just Yet, Scotty!

“Fight Against Stupidity And Bureaucracy”

.

You will get what the title is all about later. Let’s just say for now I’ll still be buying my airplane tickets and enduring the rigors of airport security for a few years longer.

As for now it’s Fact Day so have a look at the current offerings.

Enjoy.

.

did you know2

.

In cold weather keeping your cell phone

as close to your body as you can,

or in the inside pocket of an insulated base layer

will help keep it warm and prolong battery life.

 warm cell phone case

.

.

In the West women usually start shopping for baby things

as soon as they discover they’re pregnant

but in China a pregnant Chinese woman will avoid

getting a stroller before her baby is born because

according to Chinese tradition it’s considered

bad luck to have an empty stroller in the house

while you’re pregnant.

 stroller

.

.

The world’s oldest-known formula for toothpaste

was created by the ancient Egyptians

who used crushed rock salt, mint, dried iris flowers,

and pepper and mixed them to create a cleaning powder.

Research suggests this ancient toothpaste was more

effective than formulas used as recently as a century ago,

although it did have the unfortunate side effect

of causing bleeding gums.

 toothpaste

.

.

A scientific study has suggested that if you

are stressing over an important test or exam,

writing down your feelings on a piece of paper

before an exam will allow you to achieve higher scores.

 writing down your feelings on a piece of paper

.

.

Contrary to many theories,

the tongue does not have specific receptor areas

for bitter, sour, salty, and sweet flavors.

In fact, there is a fifth taste (umami, for savory/meaty flavors)

and all zones of the tongue can sense all flavors.

 all zones of the tongue can sense all flavors

.

.

After banning the Nobel Prize,

Adolf Hitler developed his own version

– the German National Prize for Art and Science.

Ferdinand Porsche was one of the awardees

for being the man behind the world’s first

hybrid car and for the Volkswagen Beetle.

 German National Prize for Art and Science

.

.

In a statement he gave to the New York Times in 1909,

Nikola Tesla predicted that it would soon be possible

to transmit messages via personal devices.

Today, we have wireless communication devices

that we bring with us anywhere we go.

 Nikola Tesla

.

.

A month after the USSR sent Sputnik 1 into space,

they sent Sputnik 2, which was the first spacecraft

to carry an animal (a dog named Laika) into space.

However, despite the Soviets initially claiming that

Laika had survived in orbit for a week,

decades later official Russian sources revealed

that Laika lived only a few hours

before dying from overheating.

Brave little doggie though.

 Laika

.

.

During WWI “Hello Girls,” as American

soldiers called them, were American women

who served as telephone operators for

Pershing’s forces in Europe.

The women were fluent in French and English

and were specially trained by the American

Telephone and Telegraph Company.

In 1979, the U.S. Army finally gave war medals

and veteran benefits to the few Hello Girls who were still alive.

 WWI Hello Girls

.

.

In its early days YouTube’s founders used

Craigslist to try to popularize the site

by offering $100 to attractive girls who would

post ten or more videos of themselves.

Unfortunately, they didn’t get a single response.

 craigslist logo

.

.

The phrase ‘Don’t judge a book by its cover’

goes back to at least the mid-nineteenth century

as found in George Eliot’s ‘The Mill on the Floss’ (1860),

where Mr. Tulliver uses the phrase in discussing

Daniel Defoe’s ‘The History of the Devil’,

saying how it was beautifully bound.

Its general meaning today, of course, is that

we shouldn’t judge or make a decision about

someone or something based on a brief

impression or outward appearance.

Wise advice.

 Don’t judge a book by its cover

.

.

Just as true champagne must hail from France,

tequila has Denomination of Origin,

meaning that it has to be produced in Mexico,

mainly in the western Mexican state of Jalisco.

The states of Guanajuato, Michoacan, Nayarit,

and Tamaulipas are also acceptable.

 taquila bottles

.

.

Located in the city of Taipei in Taiwan, the

D.S. Music Restaurant has nothing to do with music at all.

In fact, it is a bizarre hospital-themed restaurant

where waitresses are all dressed as nurses,

tables are made from metal hospital beds,

drinks are served in IV bottles and

walls are decorated with X-ray scans.

 D.S. Music Restaurant Taiwan

.

.

Remember the teleporter Star Trek?

Well, it’s no longer science fiction because now

matter can be dissolved into particles, transported

and reassembled at another location.

However, it won’t be available for use on humans

in the near future because at the moment,

whilst it is indeed possible to scan every molecule

in the human body and reassemble it in another area,

according to Quantum physics, scanning and

reassembling changes the entire object.

You can’t make an exact copy.

So don’t beam me up just yet, Scotty!

.

.

======================================

.

 

Featuring Fasab’s Fun Fact File

“Fight Against Stupidity And Bureaucracy”

.

Today we are featuring Fasab’s Fun Fact File.

Another selection of random and interesting facts that may well come in handier than you think! 

And you are about to read, or try to, some of the longest words ever presented in the history of blog!!!

Enjoy.

.

.

Honeybees use the sun as a compass which helps them navigate

nature's compass

.

. 

An average driver spends approximately 2 hours and 14 minutes

kissing in their car in a lifetime

kiss car

.

The highest recorded speed of a sneeze is 165 km per hour

sneeze-cartoon

.

. 

Actress Jamie Lee Curtis invented a special diaper for babies that has a pocket

jamie-lee-curtis-diaper-patent

.

. 

On an American one-dollar bill,

there is an owl in the upper right-hand corner of the “1” encased in the “shield”

and a spider hidden in the front upper right-hand corner

United_States_one_dollar_bill,_obverse,upper_right

.

A dog by the name of Laika was launched into space

aboard the Russian spacecraft Sputnik 2 in 1957

laikalogo

.

.

On average, an American home has 3-10 gallons of hazardous materials

hazmat

.

People whose mouth has a narrow roof are more likely to snore.

This is because they have less oxygen going through their nose

snoreCartoon

.

In one day, a human sheds 10 billion skin flakes.

This amounts to approximately two kilograms in a year

skinflakes

.

.

The Arctic Ocean covers an area of about 14,056,000 sq miles

arctic_ocean

.

Over 50% of lottery players go back to work after winning the jackpot

lottery winners

.

. 

The phrase

“Often a bridesmaid, but never a bride,”

actually originates from an advertisement

for Listerine mouthwash from 1924

often-a-bridesmaid-but-never-a-bride-i5

.

A cesium atom in an atomic clock beats over nine billion times a second.

Cesium fountain atomic clock

.

. 

Pluto was discovered on February 10, 1930 by Clyde Tombaugh

pluto

.

. 

America’s longest place-name is really Massachusetts’

“Lake Chargoggagoggmanchauggagoggchaubunagungamauugg”

Native American for

“you fish on your side, I fish on my side, nobody fish in the middle,”

It is also known as Lake Webster.

Lake Chargoggagoggmanchauggagoggchaubunagungamauugg

.

The longest town name in the United Kingdom (and Europe) is in Wales

“Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch”

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch

.

. 

In New Zealand there is

“Taumata­whakatangihanga­koauau­o­tamatea­turi­pukakapiki­maunga­horo­nuku­pokai­whenua­kitanatahu”,

which translates roughly as

“The summit where Tamatea, the man with the big knees, the climber of mountains,

the land-swallower who travelled about, played his nose flute to his loved one”.

At 85 letters, it has been listed in the Guinness World Records as the longest place name in the entire world.

Taumata­whakatangihanga­koauau­o­tamatea­turi­pukakapiki­maunga­horo­nuku­pokai­whenua­kitanatahu

.

But that doesn’t include the formal name or Bangkok, Thailand which is over 150 letters long

“Krungthepmahanakonbowornratanakosinmahintarayudyayamahadiloponoparatanarajthan

iburiromudomrajniwesmahasatarnamornpimarnavatarsatitsakattiyavisanukamphrasit”

The translation here is pretty much the unabridged history of the city rather than a word. 

krungthep mahanakhon

The land of angels, the great city of

amorn rattanakosin

immortality, various of devine gems,

mahintara yudthaya mahadilok pohp

the great angelic land unconquerable,

noparat rajathanee bureerom

land of nine noble gems, the royal city, the pleasant capital,

udomrajniwes mahasatarn

place of the grand royal palace,

amorn pimarn avaltarnsatit

forever land of angels and reincarnated spirits,

sakatattiya visanukram prasit

predestined and created by the highest devas.

Bangkok

.

.

==========================================

.