Disappearing Beaches And Dead Fish – It’s Fact Day.

“Fight Against Stupidity And Bureaucracy”

.

Two of the facts today do indeed relate to disappearing beaches and dead fish.

Rather surprisingly though, the two facts are not related.

Find out for yourself below.

And enjoy.

.

did you know1

.

The optic nerve,

which connects the eyes to the brain,

is too sensitive to successfully reconstruct.

 optic nerve

.

.

The most powerful conventional (non-nuclear) weapon

in the world is the

Aviation Thermobaric Bomb of Increased Power (ATBIP),

nicknamed “Father of All Bombs” or “FOAB’,

a Russian-made air-delivered/land-activated

thermobaric weapon whose destructive power,

according to Russian deputy chief of the general staff

Alexander Rukshin was such that,

“all that is alive merely evaporates.”

The bomb is reportedly four times as powerful as the

US military’s Massive Ordnance Air Blast bomb or “MOAB”

mentioned in last week’s fasab facts.

 Father of All Bombs

.

.

South Africa has eleven official languages,

the highest number of any country in the world.

 South Africa has eleven official languages

.

.

Swansea Jack was a black retriever dog from Wales

with a big heart and lots of courage that became

famous in the 1930s for rescuing people from the sea.

He saved twenty-seven people and won many

awards for his heroic acts.

Swansea Jack is the only dog to have been

awarded two bronze medals

(‘the canine Victoria Cross’)

by the National Canine Defence League

(now known as Dogs Trust).

 Swansea Jack

.

.

Vitamin E acts as an antioxidant in the body

and supports the immune system in

fighting off bacteria and viruses.

Almonds, as well as other nuts like peanuts

and hazelnuts are high sources of vitamin E.

One ounce of dry roasted almonds

contains 6.8 mg of vitamin A,

which is 34% of the daily recommended value.

 dry roasted almonds

.

.

The first book bought on Amazon was called

‘Fluid Concepts and Creative Analogies:

Computer Models of the Fundamental Mechanisms of Thought.’

 first book bought on Amazon

.

.

Charles Cunningham Boycott was a British

land agent living in 19th century Ireland,

who was ostracized by his local community after

he refused his tenants´ demands for reduction in rates.

His name lives on  and is synonymous with acts of

political or social protest by voluntarily abstaining from

using, buying, or dealing with a person, organization, or country.

 Charles Cunningham Boycott

.

.

At Porthleven in Cornwall (UK) the entire sand

volume mysteriously disappeared due to a freak tide,

but after a second high tide a few hours later,

the entire sand volume was re-deposited on the beach,

returning it to its original state.

A case of now you don’t see it, now you do!

(David Copperfield was not around at the time.)

 map Porthleven in Cornwall

.

.

The Chevrolet Silverado is a mega-selling full-size

and heavy-duty pickup truck manufactured

by General Motors and introduced in 1999

as the successor to the long-running Chevrolet C/K line.

In 2014 Cheverolet sold 529,755 Silverados,

or almost 1 every minute.

 Chevrolet Silverado

.

.

During the medieval period, London and Paris

each had no more than forty thousand residents.

In contrast cities, such as Constantinople and Baghdad,

had about a million people each.

 Medieval London

.

.

The voices of Mickey & Minnie Mouse,

Wayne Allwine & Russi Taylor,

married each other in real life, too.

 Wayne Allwine & Russi Taylor wedding

.

.

Vending machines kill more people per year

than sharks and snakes combined.

According to the available police reports

the deaths usually happen when the vending machine

steals somebody’s snack, drink, or money,

and they decide to hit it a bit too hard causing

the vending machine to fall on them.

 Vending machine

.

.

In the German city of Hamburg in 1842,

about a quarter of the inner city was destroyed

and an estimated twenty thousand lost their property.

Surprisingly only fifty-one people lost their lives.

 Hamburg in 1842

.

.

In Lyme Regis, a little coastal town

in West Dorset, England,

slapping people with a dead eel is prohibited.

There had been a tradition known as

“the conger-cuddling”, in which people swung

dead eels at each other but in 2006,

the game was banned by local bureaucrats not

because it might have injured the people taking

part in this activity but because

– wait for it –

an animal rights group claimed

it was disrespectful to the dead fish.

 conger_cuddling

.

.

Wallilabou Anchorage, situated at Wallilabou Bay

on the west or leeward coast of the main island

of St Vincent on the Caribbean Sea,

was the principal Caribbean location for

Disney’s 2003 blockbuster ‘Pirates of the Caribbean’.

It is still home to many of the props,

including replicas of cannons.

Many fans visit it annually.

.

.

===============================

.

It’s March 17th So Some Facts About Saint Patrick Today.

“Fight Against Stupidity And Bureaucracy”

.

march 17 st patrick's day

.

Happy Saint Patrick’s Day to one and all who celebrate these things.

Grab a glass of your green beer and find out a few facts about St. Patrick that you may find interesting and a little surprising.

Enjoy.

.

donald duck st patrick's day

.

Let’s start with this fact,

Saint Patrick wasn’t Irish

and he wasn’t born in Ireland.

Although he is remembered for introducing

Christianity to Ireland in the year 432, Patrick was

born to Roman parents in Scotland or Wales in

the late fourth century (about 385 AD)

so actually he’s British!

 

British Order of St Patrick
British Order of St Patrick

.

.

And while we are doing a bit of myth-busting,

you might as well also know that the

Shamrock is not the symbol of Ireland.

It is a popular Irish symbol,

but the symbol of Ireland is the Harp.

As early as the medieval period, the harp appeared

on Irish gravestones and manuscripts and was

popular in Irish legend and culture well before that.

King Henry VIII used the harp on coins as early as 1534.

Later, it was used on Irish flags and Irish coats of arms.

Starting in 1642 the harp also appeared on flags

during rebellions against English rule and when

Ireland became an independent country in 1921,

it adopted the harp as the national symbol.

Harp national symbol of Ireland
The Harp is the national symbol of Ireland.

.

.

Although today many people claim that

the shamrock represents faith, hope, and love,

or any number of other things,

it was actually used by Patrick to teach

the mystery of the Holy Trinity,

and how three things,

the Father, The Son, and the Holy Spirit

could be separate entities, yet one in the same.

Obviously, the pagan rulers of Ireland found

Patrick to be convincing because they

quickly converted to Christianity.

 Holy-Trinity-Shamrock

.

.

Patrick’s first introduction to the Irish was not a pleasant one.

At the age of 16, he had the misfortune of

being kidnapped by Irish raiders who took him away

and sold him as a slave.

He spent several years in Ireland herding sheep

and learning about the people there.

At the age of 22, he managed to escape and

made his way to a monastery in England where

he spent 12 years growing closer to God.

 (St) Patrick being given the opportunity to leave Ireland where he had been held as a slave

.

.

The original color associated with St. Patrick is blue,

not green as commonly believed.

In several artworks depicting the saint,

he is shown wearing blue vestments.

King Henry VIII used the Irish harp in gold

on a blue flag to represent the country.

Since that time, and possibly before,

blue has been a popular color to represent

the country on flags, coats-of-arms,

and even sports jerseys.

Ireland’s association with the color green

came later, presumably because of the greenness

of the countryside, caused by endless rainfall.

Today, the country is also referred to as the “Emerald Isle.”

 saint patrick color blue

.

.

The St. Patrick‘s Day parade was invented

in the United States, not Ireland.

On March 17, 1762, Irish soldiers serving in the British army

marched through New York City, the parade and accompanying

music helping the soldiers celebrate their Irish roots,

as well as reconnect with fellow Irishmen

serving in the British army.

In 1848, several New York Irish Aid societies united

their parades to form one official New York City

St. Patrick’s Day Parade which has become one of the

largest St Patrick’s parades with about 200,000

participants and 3 million onlookers.

It is also the oldest civilian parade in the United States.

Only the City of Boston rivals it.

 st patrick's day parade new york city

.

.

By contrast, the world’s shortest St. Patrick’s Day

parade is in Dripsey, Cork, where the

parade lasts just 100 yards and

travels between the village’s two pubs.

 St. Patrick’s Day parade Dripsey Cork

.

.

And only the Irish know why this parade goes from

one pub to the other because until 1970 St. Patrick’s

was what was known as a dry holiday in Ireland,

meaning that all pubs were shut down for the day.

The law was overturned in 1970, when St. Patrick’s

was reclassified as a national holiday

– cheers to that!

 green-beer

.

.

In the United States during the mid 19th century,

the Roman Catholic Irish faced discrimination

much like that faced by African Americans.

Unlike the Protestant Irish who quickly assimilated

into their new country and became Americans,

(their descendants now number many millions in the USA),

the Roman Catholic Irish clung to their religion and culture

and were perceived as a potentially disloyal.

To combat this, they began to organize themselves politically

and by the end of the 19th century, St. Patrick’s Day was

a large holiday for the Roman Catholic Irish and an occasion

for them to demonstrate their collective political and social might.

In more recent times the political emphasis has faded along with

the discrimination, and the holiday has now become popular as an

opportunity for festivity regardless of one’s cultural background.

 St. Patrick’s Day parade new york roman catholic irish

.

.

The New York and Boston St. Patrick’s Day celebrations

may well be impressive in their own right,

but they have a rival.

St Patrick’s Day has twice been celebrated in space.

In 2011, the International Space Station hosted

a St. Paddy’s Day celebration with Irish-American

astronaut Catherine Coleman playing a hundred-year-old flute

and a tin whistle belonging to members

of the Irish group, the Chieftains,

while floating weightlessly in space.

Coleman’s performance was included in a track entitled

”The Chieftains In Orbit” on the group’s album, ‘Voice of Ages’.

And in 2013, astronaut, Chris Hadfield, celebrated

St Patrick’s Day by photographing Ireland from

space while singing Danny Boy.

.

.

=====================================

.

 

Significant Number Factoid Friday – Today The Number Is Sixty-Four 64

“Fight Against Stupidity And Bureaucracy”

.

Another significant numbers day.

In case you are wondering these numbers are picked quite randomly. Only after it makes itself known does the search start for things associated with it.

Sometimes there is a lot, sometimes not so much. Sixty-four seems to be a well used number so a lot of information below.

If you are into numbers, enjoy.

.

.

The Number Sixty-Four  64

.

64

.

In religion

  • The 64th word of the King James Version of the Bible’s Old Testament Genesis is “light”;
  • King David prays for deliverance from his enemies in the 64th Psalm;
  • The 64 Dakinis or Yoginis are 8 Mother goddesses each with 8 attendants in India religious traditions; each of the 64 can be further correlated to the currents or winds of the human “etheric” body;
  • The Lord Shiva has 64 forms or manifestations.

.

.

.

In mathematics

  • Sixty-four is the square of 8, the cube of 4, and the sixth power of 2;
  • Sixty-four is the smallest number with exactly seven divisors;
  • Sixty-four is the lowest positive power of two that is adjacent to neither a Mersenne prime nor a Fermat prime;
  • Sixty-four  is the sum of Euler’s totient function for the first fourteen integers;
  • Sixty-four is also a dodecagonal number and a centered triangular number;
  • In base 10, no integer added up to its own digits yields 64, hence it is a self number;
  • Sixty-four is a super-perfect number – a number such that s(s(n))=2n.

.

  • Base64
  • Base64 is a group of similar binary-to-text encoding schemes that represent binary data in an ASCII string format by translating it into a radix-64 representation. The term Base64 originates from a specific MIME content transfer encoding.
  • Base64 encoding schemes are commonly used when there is a need to encode binary data that needs to be stored and transferred over media that are designed to deal with textual data. This is to ensure that the data remain intact without modification during transport.
  • Base64 is commonly used in a number of applications including email via MIME, and storing complex data in XML.

.

  • Graham’s number
  • Graham’s number, named after Ronald Graham, is unimaginably larger than other well-known large numbers such as a googol, googolplex, and even larger than Skewes’ number and Moser’s number.
  • The number gained a degree of popular attention when Martin Gardner described it in the “Mathematical Games” section of Scientific American in November 1977, writing that, “In an unpublished proof, Graham has recently established … a bound so vast that it holds the record for the largest number ever used in a serious mathematical proof.” The 1980 Guinness Book of World Records repeated Gardner’s claim, adding to the popular interest in this number.
  • Specific integers known to be far larger than Graham’s number have since appeared in many serious mathematical proofs (e.g., in connection with Friedman’s various finite forms of Kruskal’s theorem).

.

.

.

In Computing

  • 64-bit
  • In computer architecture, 64-bit computing is the use of processors that have datapath widths, integer size, and memory addresses of 64 bits (eight octets) wide. Also, 64-bit CPU and ALU architectures are those that are based on registers, address buses, or data buses of that size. From the software perspective, 64-bit computing means the use of code with 64-bit virtual memory addresses

64 bit is the future

.

  • Commodore 64
  • The Commodore 64, commonly called C64, CBM 64 (for Commodore Business Machines), or VIC-64, is an 8-bit home computer introduced in January 1982 by Commodore International.
  • Volume production started in the spring of 1982, with machines being released on to the market in August at a price of US$595.
  • Preceded by the Commodore VIC-20 and Commodore PET, the C64 took its name from its 64 kilobytes (65,536 bytes) of RAM, and had favorable sound and graphical specifications when compared to contemporary systems such as the Apple II, at a price that was well below the circa US$ 1200 demanded by Apple.
  • For a substantial period (1983–1986), the C64 dominated the market with between 30% and 40% share and 2 million units sold per year, outselling the IBM PC compatibles, Apple Inc. computers, and Atari 8-bit family computers.
  • Sam Tramiel, a later Atari president and the son of Commodore’s founder, said in a 1989 interview “When I was at Commodore we were building 400,000 C64s a month for a couple of years.”

C64 computer

.

  • Dragon 64
  • The Dragon 32 and Dragon 64 are home computers that were built in the 1980s. The Dragons are very similar to the TRS-80 Color Computer (CoCo), and were produced for the European market by Dragon Data, Ltd., in Port Talbot, Wales, and for the US market by Tano of New Orleans, Louisiana.
  • The model numbers reflect the primary difference between the two machines, which have 32 and 64 kilobytes of RAM, respectively.

Dragon-64 computer

.

.

.

In science

  • Sixty-four is the Atomic Number of Gadolinium (Gd), discovered by Jean de Marignac 1880 (Switzerland), and named after the mineral gadolinite;
  • Sixty-four is the Atomic Weight of Copper (Cu).
  • There are 64 codons in the RNA codon table under genetic code.

.

.

.

In space

  • Messier object M64, is a magnitude 9.0 galaxy in the constellation Coma Berenices, also known as the Black Eye Galaxy;
  • The New General Catalogue object NGC 64, a barred spiral galaxy in the constellation Cetus;
  • WOH G64 is a red hypergiant in the Large Magellanic Cloud. With 1540 times the radius of the Sun, it is one of the largest known stars and the largest known in the LMC. The physical parameters are still poorly known due to the distance, visual faintness, several solar masses of shrouding dust, and the possibility of a bright hot companion.

WOH_G64_Particular

.

  • STS-64
  • STS-64 was a Space Shuttle Discovery mission, launched from Kennedy Space Center, Florida, on 9 September 1994, to perform multiple experiment packages.
  • STS-64 marked the first flight of Lidar In-space Technology Experiment (LITE) and first untethered U.S. extravehicular activity (EVA) in 10 years. LITE payload employs lidar, which stands for “light detection and ranging”, a type of optical radar using laser pulses instead of radio waves to study Earth’s atmosphere.
  • On day five of the mission, the Shuttle Pointed Autonomous Research Tool for Astronomy-201 (SPARTAN-201) free flyer was released using the Remote Manipulator System arm.
  • STS-64 was the first mission to see the use of the new full-pressure Advanced Crew Escape Suit, which eventually replaced the partial-pressure Launch Entry Suit.

sts-64-patch

.

.

.

In politics

  • Department of State Form DS-64 is the one US Citizens need if they lose or have your passport stolen;
  • Department of Labor Chapter 64 regulates the employment of workers with disabilities at special wages;
  • In the United States presidential election of 1964, held on Tuesday, November 3, 1964, Democratic candidate and incumbent President Lyndon B. Johnson who had come to office less than a year earlier following the assassination of his predecessor, John F. Kennedy, and who had successfully associated himself with Kennedy’s popularity, won 61.1% of the popular vote, the highest won by a candidate since 1820.

United States presidential election  1964

  • In Chinese the “Six Four Incident” refers to Tiananmen Square protests of 1989.

tiananmen-square-1989

.

.

.

In sport

  • There are 64 teams participating in the NCAA Basketball Tournament;
  • In chess or draughts, there are a total of 64 black (dark) and white (light) squares on the game board;
  • The Knight’s Tour of a chessboard is a sequence of moves by a knight so that each of the 64 squares is visited only once. The numbers of the knight’s moves form a magic square where each row and column adds up to 260;
  • 64 is the name of the premier Russian chess magazine;
  • NFL Hall of Famers with jersey #64 include Dave Wilcox, Linebacker (Boise Junior College, Oregon) and 1964-1974 San Francisco 49ers; George Blanda, Quarterback-Kicker, 1949, 1950-58 Chicago Bears, 1950 Baltimore Colts, 1960-66 Houston Oilers, 1967-1975 Oakland Raiders; Joe Delamielleure, Guard, 1973-1979, 1985 Buffalo Bills, 1980-1984 Cleveland Browns; Randall McDaniel, Guard, 1988-1999 Minnesota Vikings, 2000-01 Tampa Bay Buccaneers; Y.A. Tittle, Quarterback, 1948-1950 Baltimore Colts (AAFC/NFL), 1951-1960 San Francisco 49ers, 1961-1964 New York Giants.

Y A Tittle

  • In the National Hockey League, jersey #64 is used by James Robert McGinn IV is a Canadian professional ice hockey player currently playing for the Colorado Avalanche.

James McGinn

.

.

.

In books, movies, music and TV

  • The $64,000 Question is an American game show broadcast from 1955–1958, which became embroiled in the scandals involving TV quiz shows of the day. The $64,000 Challenge (1956–1958) was its popular spin-off show.
  • When I’m 64 is a song by John Lennon & Paul McCartney from The Beatles’ Sgt. Pepper’s Lonely Hearts Club Band album (1967).


.

.

.

In militaria

  • HMS Vansittart
  • HMS Vansittart was an Admiralty modified W class destroyer built for the Royal Navy. She was ordered in January 1918 from William Beardmore & Company with the 13th Order for Destroyers of the Emergency War Program of 1918-19. She was the second Royal Navy ship to carry the name which was first used in 1821 for a hired packet.

HMS_Vansittart (D64)

.

  • HMS Beverley (H 64)
  • Completed in July 1920 as USS Branch (DD 197) for the US Navy, on 8 Oct, 1940 she was transferred to the Royal Navy and renamed HMS Beverley (H 64).
  • On 9 Apr, 1943, during WWII convoy duty in the North Atlantic, HMS Beverley had been seriously damaged in a collision with the British steam merchant Cairnvalona and had taken station in the rear of the convoy. When it was subsequenty attaced by a German U-Boat, U-188, 30 hours later she was hit by torpedos and sunk. HMS Clover (K 134) (Lt P.H. Grieves, RNR) later picked up five survivors and recovered two bodies, but one of the survivors later died on board.

hms_beverley

.

  • HMS Fencer (D64)
  • The USS Croatan (CVE-14) (originally AVG-14 then ACV-14) was transferred to the United Kingdom on 20 February 1943 under lend-lease where she served as HMS Fencer (D64). As an anti-submarine warfare carrier, Fencer escorted Atlantic, Russian and African convoys, even participating in a strike on the German battleship Tirpitz before being transferred to the Pacific.
  • Following World War II, she returned to the United States 21 December 1946, stricken for disposal on 28 January 1947 and sold into merchant service 30 December as Sydney.
  • The ship went through a series of renamings, first to Roma in 1967, then Galaxy Queen in 1970, Lady Dina in 1972 and finally Caribia in 1973 before being scrapped in Spezia in September 1975.

HMS_Fencer_D64

.

  • HMS Scorpion (D64)
  • HMS Scorpion (D64) was a Weapon-class destroyer of the British Royal Navy. Originally named HMS Centaur, the ship was renamed Tomahawk and finally Scorpion (in September 1943) before her launch.
  • Scorpion was the only Weapon-class ship fitted with the Limbo depth charge mortar rather than the older Squid.
  • In 1953 she took part in the Fleet Review to celebrate the Coronation of Queen Elizabeth II.

HMS Scorpion D64

.

  • HMS Theseus (R64)
  • HMS Theseus (R64) was a Colossus-class light fleet aircraft carrier of the Royal Navy, launched on 6 July 1944.
  • Theseus was laid down to serve in the Second World War, but was not completed before peace was declared in 1945. She was utilized as a training vessel until the outbreak of the Korean War when she was deployed to Korea, commencing standard carrier operations.
  • In 1956, Theseus was used as an emergency commando carrier, along with her sister-ship Ocean, during the Suez Crisis. From November to December, helicopters from Theseus transported troops ashore, as well as evacuating wounded soldiers. Compared to her actions during the Korean War, her role at Suez was relatively quiet. The following year she was placed in reserve. She was subsequently broken up at Inverkeithing in 1962.

HMS Theseus (R64)

.

  • USS Wisconsin (BB-64)
  • The USS Wisconsin (BB-64), “Wisky” or “WisKy”, is an Iowa-class battleship, the second ship of the United States Navy to be named in honor of the U.S. state of Wisconsin. She was launched on 7 December 1943 (the second anniversary of the Pearl Harbor raid).
  • During her career, Wisconsin served in the Pacific Theater of World War II, where she shelled Japanese fortifications and screened United States aircraft carriers as they conducted air raids against enemy positions.
  • During the Korean War, Wisconsin shelled North Korean targets in support of United Nations and South Korean ground operations, after which she was decommissioned.
  • She was reactivated 1 August 1986, modernised and participated in Operation Desert Storm in January and February 1991.
  • Wisconsin was last decommissioned in September 1991, having earned a total of six battle stars for service in World War II and Korea, as well as a Navy Unit Commendation for service during the January/February 1991 Gulf War.
  • She currently functions as a museum ship operated by Nauticus, The National Maritime Center in Norfolk, Virginia. .

Uss_wisconsin

.

  • USS Constellation (CV-64)
  • The USS Constellation (CV-64), a Kitty Hawk–class supercarrier, was the third ship of the United States Navy to be named in honor of the “new constellation of stars” on the flag of the United States and the only naval vessel ever authorized to display red, white, and blue designation numbers.
  • One of the fastest ships in the Navy, as proven by her victory during a battlegroup race held in 1985, she was nicknamed “Connie” by her crew and officially as “America’s Flagship”.
  • She was launched 8 October 1960 and delivered to the Navy 1 October 1961, and commissioned 27 October 1961, with Captain T. J. Walker in command. At that time, she had cost about US$264.5 million. Constellation was the last U.S. aircraft carrier (as of 2010) to be built at a yard other than Newport News Shipbuilding & Drydock Company.

USS_Constellation_CV-64

.

  • USS Gettysburg (CG-64)
  • The USS Gettysburg (CG-64) is a Ticonderoga-class guided-missile cruiser in the United States Navy, built at the Bath Iron Works in Maine and named for the Battle of Gettysburg during the American Civil War.
  • With her guided missiles and rapid-fire cannons, she is capable of facing and defeating threats in the air, on the sea, or ashore, and underneath the sea. She also carries two Seahawk LAMPS multi-purpose helicopters, but mainly for anti-submarine warfare (ASW).
  • She is based in Mayport, Florida.

USS_Gettsyburg_(CG-64)

.

  • U-64
  • The first U-64 was a Type U-63 class submarine in the Kaiserliche Marine that served during World War I. She was built in 1916 and served in the Mediterranean Sea.
  • On 19 March 1917, while on patrol in the Tyrrhenian Sea, U-64 torpedoed and sank the French battleship Danton 30 miles south of Sardinia, with the loss of 296 men. She herself was lost on 17 June 1918.

u_64_u_63_type_u_boot 1915-1918

.

  • In 1937 another German submarine U-64, a Type IXB U-boat of the Nazi German Kriegsmarine, was ordered in July 1937 and launched in September 1939.
  • This U-64 had a very short career and sank no enemy vessels. Having left her home port of Wilhelmshaven for her first war patrol on 6 April 1940, she was intercepted by Allied aircraft seven days later off the coast of Norway during the invasion of that country and was sunk by a bomb from a Fairey Swordfish aircraft of HMS Warspite. Of her crew of 46, eight men died and 38 escaped from the sinking submarine.

.

  • K-64
  • The K-64 Designation was first given to the first Alfa Class Submarine, launched on April 22, 1969.
  • In 1972, the submarine suffered a major reactor problem in the form of a leak of liquid metal coolant. The superheated metal solidified on contact with the colder outside air, freezing and damaging internal components of the reactor. She was removed from service and towed to Severodvinsk.
  • The K-64 designation was again given to a Delta IV class submarine launched on February 2, 1986 as the fourth ship of its class, entered in service in the Russian Northern Fleet. The sub was laid down in December 1982 and was built at Sevmash plant in Severodvinsk.
  • This ship is still in active service.

Soviet submarine K-64

.

  • P-64
  • P-64 was the designation assigned by the United States Army Air Corps (USAAC) to the North American Aviation NA-68 fighter, an upgraded variant of the NA-50 developed during the late 1930s.
  • Six NA-68s ordered by the Royal Thai Air Force were seized before export by the US government in 1941, after the Franco-Thai War and growing ties between Thailand and the Empire of Japan. These aircraft were used by the USAAC as unarmed fighter trainers.
  • Seven NA-50s were purchased by the Peruvian Air Force, which nicknamed it Torito (“Little Bull”). The Peruvian NA-50s subsequently saw action during the Ecuadorian-Peruvian War of 1941.

na_p-64

.

  • The Grumman G-64/111 Albatross
  • The Albatross is easily the largest of Grumman’s series of utility amphibians, and was the only one originally developed specifically for military service.
  • The Albatross resulted from a late 1940s US Navy requirement for a general purpose amphibious transport. The first Albatross prototype flew for the first time on October 24 1947, with more than 400 production HU-16s subsequently delivered to the US Navy, US Coast Guard and 12 other nations. Military Albatross missions included general reconnaissance, maritime patrol, anti submarine warfare (in which role it could be armed with torpedoes and depth charges) and search and rescue.
  • In the late 1970s, Grumman and major US flying boat operator Resorts International began work on a program to convert the Albatross for civil airline service. The conversion incorporated numerous changes to the basic Albatross, including a 28 seat passenger interior, a galley and provision for a flight attendant, upgraded avionics and other improved systems.
  • In all only 13 aircraft were converted, 12 for Resorts International, and 1 for Conoco Oil/Pelita which operated from Singapore. Several of these are still active, together with ex military examples.

Grumman albatross

.

  • AH-64 Apache
  • The Boeing AH-64 Apache is a four-blade, twin-engine attack helicopter with a tailwheel-type landing gear arrangement, and a tandem cockpit for a two-man crew.
  • Originally, the Apache started life as the Model 77 developed by Hughes Helicopters for the United States Army’s Advanced Attack Helicopter program to replace the AH-1 Cobra, and was first flown on 30 September 1975.
  • The AH-64 was introduced to U.S. Army service in April 1986.
  • The AH-64 Apache features a nose-mounted sensor suite for target acquisition and night vision systems; is armed with a 30-millimeter (1.2 in) M230 Chain Gun carried between the main landing gear, under the aircraft’s forward fuselage; and has four hardpoints mounted on stub-wing pylons, typically carrying a mixture of AGM-114 Hellfire missiles and Hydra 70 rocket pods. The AH-64 has a large amount of systems redundancy to improve combat survivability.
  • The first production AH-64D Apache Longbow, an upgraded version of the original Apache, was delivered to the Army in March 1997. Production has been continued by Boeing Defense, Space & Security; over 1,000 AH-64s have been produced to date.
  • The U.S. Army is the primary operator of the AH-64; it has also become the primary attack helicopter of multiple nations, including Greece, Japan, Israel, the Netherlands and Singapore; as well as being produced under license in the United Kingdom as the AgustaWestland Apache. U.S. AH-64s have served in conflicts in Panama, the Persian Gulf, Kosovo, Afghanistan, and Iraq. Israel used the Apache in its military conflicts in Lebanon and the Gaza Strip; both British and U.S. Apaches have seen deployments in Afghanistan and Iraq.

AH-64D_Apache_Longbow

.

  • Sikorsky S-64 Skycrane
  • The Sikorsky S-64 Skycrane is an American twin-engine heavy-lift helicopter, the civil version of the United States Army’s CH-54 Tarhe. The S-64 Aircrane is the current production version, manufactured by the Erickson Air-Crane company.
  • Erickson Air-Crane purchased the type certificate and manufacturing rights in 1992 and since that date they have become the manufacturer and world’s largest operator of S-64 Aircranes. The Aircrane can be fitted with a 2,650-gallon (~10,000 litre) fixed retardant tank to assist in the control of bush fires, and it has proved itself admirably in this role.
  • Erickson is manufacturing new S-64s, as well as remanufacturing existing CH-54s, with each being assigned an individual name, the best-known being “Elvis”, used in fighting fires in Australia alongside “The Incredible Hulk” and “Isabelle”.
  • Other operators, such as Siller Brothers, have followed with their Sikorsky S-64E, Andy’s Pride. The Erickson S-64E nicknamed “Olga” was used to lift the top section of the CN Tower into place in Toronto, Canada.
  • The S-64 is the first helicopter built with a rear-facing pilot’s seat—this allows the pilot to watch exactly where the load is being placed as he’s flying the helicopter. The feature came in handy in 1993, when an S-64 removed and replaced the Statue of Freedom from the US Capitol building during a renovation. When transporting a big load like that, the S-64 uses an anti-rotation rigging system that prevents the aircraft from twisting and swaying.

Sikorsky S64

.

  • T-64
  • The T-64 is a Soviet main battle tank, introduced in the early 1960s. It was a more advanced counterpart to the T-62: the T-64 served tank divisions, while the T-62 supported infantry in motor rifle divisions. Although the T-62 and the famed T-72 would see much wider use and generally more development, it was the T-64 that formed the basis of more modern Soviet tank designs like the T-80.

T-64 tank

.

  • W64 nuclear warhead
  • The W64 nuclear warhead was the Los Alamos Laboratory’s entry into a brief competition between Lawrence Livermore Laboratory and Los Alamos to design an “enhanced-radiation” nuclear warhead (i.e., a “neutron bomb”) for the United States Army’s MGM-52 Lance tactical surface-to-surface missile.
  • The Los Alamos design, the W64, was canceled in September 1964 in favor of Livermore’s W63. In November 1966, the W63 was canceled in favor of the W70, the model that finally entered production.

.

  • L64
  • The L64 was an intermediate calibre British bullpup layout prototype assault rifle developed in the 1970s. The British Army had considered bullpup designs with intermediate calibre rounds in the 1950s, and officially adopted one of these as .280 British in 1951 in the EM-2 and Taden gun. However, US intransigence during NATO standardization efforts, and Winston Churchill’s interest in standards above all, led to the adoption of the significantly more powerful 7.62×51mm NATO round and the British and Canadian armies adopted the L1A1 SLR, a licensed version of the FN FAL, itself originally designed for the .280.
  • In the late 1960s a new L64/65 “Individual Weapon” was developed, outwardly similar to the earlier EM-2, but adopted a firing mechanism very similar to ArmaLite’s latest AR-18 design. The first examples were available in 1972.
  • By 1976, NATO was ready to standardize on a small calibre round, and testing of the various rounds head-to-head started in 1977. As designed, the British round out-performed the standard US 5.56 mm. However Fabrique Nationale’s entry based on the 5.56 mm, the “SS-109” performed as well as the British cartridge. In the end it was selected largely due to its similarity with existing US ammunition.
  • The L64 pattern was later developed into the SA80 family of weapons, which entered service with the UK in the 1980s.

L64-Enfield_bullpup_prototype

.

  • P-64 Pistol
  • The P-64 is a Polish 9mm semi-automatic pistol designed to fire the 9x18mm Makarov cartridge. The pistol was developed in the late 1950s at the Institute for Artillery Research, which later became the Military Institute of Armament Technology.

P64 pistol

.

.

.

In other fields

  • Cities situated on longtitude 64 degree west are:  Charlotte Amalie,  US Virgin Islands; Hamilton,  Bermuda; Road Town,  British Virgin Islands; and Córdoba, Argentina.
  • Cities situated on latitude 64 north are:  Fairbanks, Alaska; Skellefteå, Sweden; Anadyr and Arkhangelsk, Russia; Nuuk (Godthåb), Greenland; and Reykjavík, Iceland.
  • There are 64 gems in total number in a standard Bejeweled game board.
  • 64 is the code for international direct dial calls to New Zealand.
  • There are 64 Braille characters in the old 6-dot system.
  • Since 1996, the number 64 has been an abbreviation or slang for Nintendo 64 (though N64 is more common) along with the games Super Mario 64, Mario Kart 64 and more.

Nintendo_64_Logo

  • 64 is the maximum number of strokes in any Chinese character.
  • There are 64 hexagrams in the I Ching.
  • There are 64 sexual positions in the Kama Sutra.
  • There are 64 demons in the Dictionnaire Infernal.
  • There are 64 classical arts listed in many Indian scriptures. They include: singing, dancing, painting, poetry, playing cards, making arguments, making flower garlands, etc.
  • The 64th French department is Pyrénées-Atlantiques.
  • Unsurprisingly it is the number of crayons in the popular Crayola 64 pack.
  • 64 is the maximum stack size in the popular game Minecraft.
  • 64 (dog) is a character in the Donald Duck comics universe.
  • Number of golden disks in the myth of the Tower of Hanoi.
  • The S64-1.25 MW has a well-suited ratio of rotor diameter to generator for most sites in a medium wind speed regime. The wind turbine concept is based on robust design and is efficiently handled by the Suzlon controller. These technologies are all well-known in the wind power industry and have proven themselves over time.

Suzlon_S64-1.25-MW

  • PARALOID B-64 solid grade acrylic resin provides an outstanding combination of hardness, flexibility, and adhesion to various substrates. This general-purpose resin permits wider latitude in formulating in solvents that are suitable for specific applications.
  • Group f/64 was a group of seven 20th century San Francisco photographers who shared a common photographic style characterized by sharp-focused and carefully framed images seen through a particularly Western (U.S.) viewpoint. In part, they formed in opposition to the Pictorialist photographic style that had dominated much of the early 20th century, but moreover they wanted to promote a new Modernist aesthetic that was based on precisely exposed images of natural forms and found objects.
  • 64 is the slang term referring to a 1964 Chevrolet Impala, often configured as a lowrider, a popular subject among early-90’s gangsta rap.

1964_chevrolet_impala_ss_convertible front_view

.

============================================

.

Featuring Fasab’s Fun Fact File

“Fight Against Stupidity And Bureaucracy”

.

Today we are featuring Fasab’s Fun Fact File.

Another selection of random and interesting facts that may well come in handier than you think! 

And you are about to read, or try to, some of the longest words ever presented in the history of blog!!!

Enjoy.

.

.

Honeybees use the sun as a compass which helps them navigate

nature's compass

.

. 

An average driver spends approximately 2 hours and 14 minutes

kissing in their car in a lifetime

kiss car

.

The highest recorded speed of a sneeze is 165 km per hour

sneeze-cartoon

.

. 

Actress Jamie Lee Curtis invented a special diaper for babies that has a pocket

jamie-lee-curtis-diaper-patent

.

. 

On an American one-dollar bill,

there is an owl in the upper right-hand corner of the “1” encased in the “shield”

and a spider hidden in the front upper right-hand corner

United_States_one_dollar_bill,_obverse,upper_right

.

A dog by the name of Laika was launched into space

aboard the Russian spacecraft Sputnik 2 in 1957

laikalogo

.

.

On average, an American home has 3-10 gallons of hazardous materials

hazmat

.

People whose mouth has a narrow roof are more likely to snore.

This is because they have less oxygen going through their nose

snoreCartoon

.

In one day, a human sheds 10 billion skin flakes.

This amounts to approximately two kilograms in a year

skinflakes

.

.

The Arctic Ocean covers an area of about 14,056,000 sq miles

arctic_ocean

.

Over 50% of lottery players go back to work after winning the jackpot

lottery winners

.

. 

The phrase

“Often a bridesmaid, but never a bride,”

actually originates from an advertisement

for Listerine mouthwash from 1924

often-a-bridesmaid-but-never-a-bride-i5

.

A cesium atom in an atomic clock beats over nine billion times a second.

Cesium fountain atomic clock

.

. 

Pluto was discovered on February 10, 1930 by Clyde Tombaugh

pluto

.

. 

America’s longest place-name is really Massachusetts’

“Lake Chargoggagoggmanchauggagoggchaubunagungamauugg”

Native American for

“you fish on your side, I fish on my side, nobody fish in the middle,”

It is also known as Lake Webster.

Lake Chargoggagoggmanchauggagoggchaubunagungamauugg

.

The longest town name in the United Kingdom (and Europe) is in Wales

“Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch”

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch

.

. 

In New Zealand there is

“Taumata­whakatangihanga­koauau­o­tamatea­turi­pukakapiki­maunga­horo­nuku­pokai­whenua­kitanatahu”,

which translates roughly as

“The summit where Tamatea, the man with the big knees, the climber of mountains,

the land-swallower who travelled about, played his nose flute to his loved one”.

At 85 letters, it has been listed in the Guinness World Records as the longest place name in the entire world.

Taumata­whakatangihanga­koauau­o­tamatea­turi­pukakapiki­maunga­horo­nuku­pokai­whenua­kitanatahu

.

But that doesn’t include the formal name or Bangkok, Thailand which is over 150 letters long

“Krungthepmahanakonbowornratanakosinmahintarayudyayamahadiloponoparatanarajthan

iburiromudomrajniwesmahasatarnamornpimarnavatarsatitsakattiyavisanukamphrasit”

The translation here is pretty much the unabridged history of the city rather than a word. 

krungthep mahanakhon

The land of angels, the great city of

amorn rattanakosin

immortality, various of devine gems,

mahintara yudthaya mahadilok pohp

the great angelic land unconquerable,

noparat rajathanee bureerom

land of nine noble gems, the royal city, the pleasant capital,

udomrajniwes mahasatarn

place of the grand royal palace,

amorn pimarn avaltarnsatit

forever land of angels and reincarnated spirits,

sakatattiya visanukram prasit

predestined and created by the highest devas.

Bangkok

.

.

==========================================

.

 

 

 

Dumb Dumb Dumb – Yes, More Quiz Show Answers

“Fight Against Stupidity And Bureaucracy”

Dumb was about the only word that could describe today’s lot of quiz show contestants, but even that wasn’t enough so I said it three times (and that went along with the video at the end, who was it said, I like it when a plan comes together).

So here you are.

Hope you find something to make you smile this Monday. I’m away to count me toes.

Enjoy!

 .

.

Q:  Which American actor is married to Nicole Kidman

A:  Forrest Gump.

Q:  On which street did Sherlock Holmes live?

A:  Er . . .

Q:  He makes bread .. .

A:  Er . . .

Q:  He makes cakes .. .

A:  Kipling Street?

Q:  Which of these is a city in Germany: Hanoi, Hanover or Hangover?

A:  Hanoi.

.  

Q:  In what year was President Kennedy assassinated?

A:  Erm .. .

Q: Well, let’s put it this way – he didn’t see 1964.

A:  1965?

Q:  What’s the Prince of Wales’s Christian name?

A:  Err . . .

Q:  Here’s a clue: he was married to Diana.

A:  Err . . .

Q:  It begins with a ‘C’.

A:  No idea.

Q:  What was the name of Tony Blair’s chief spin-doctor who resigned last year?

A:  Iain Duncan Smith.

Q:  Arrange these two groups of letters to form a word – CHED and PIT.

A: Chedpit.

Q:  How many toes would three people have in total?

A:  23.

Q:  I’m looking for an island in the Atlantic whose name includes the letter ‘e’.

A:  Ghana.

Q:  No, listen. It’s an island in the Atlantic Ocean.

A:  New Zealand.

Q:  What is the world’s largest continent?

A:  The Pacific

Q:  Name a film starring Bob Hoskins that is also the name of a famous painting by Leonardo Da Vinci.

A:  Who Framed Roger Rabbit?

Q:  In which European city was the first opera house opened in 1637?

A:  Sydney.

Q:  What was signed to bring World War I to an end in 1918?

A:  Magna Carta.

Q:  What international brand shares its name with the Greek goddess of victory?

A: (after long deliberation): Erm, Kellogg’s?

Q:  Name a book written by Jane Austen.

A:  Charlotte Bronte.

Q:  What is the name of the French-speaking Canadian state?

A:  America? 

A:  Portugal? 

A:  Canada? 

A:  Mexico? 

A:  Italy? 

A:  Spain? 

Q:  How many days in a leap year?

A:  253.

Q:  What is the county town of Kent?

A:  Kentish Town?

.

Q:  Who wrote Lord of the Rings?

A:  Enid Blyton

Q:  In which European country are there people called Walloons?

A:  Wales.

Q:  Dizzy Gillespie is famous for playing . .. what?

A:  Basketball.

===================================

.